{"product_id":"proteintech-15884-1-ap","title":"Proteintech, 15884-1-AP, FKBP14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBP14 (15884-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP14 in WB, IHC, ELISA applications with reactivity to human samples\n15884-1-AP targets FKBP14 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  human brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBP14, also named as FKBP22, belongs to the family of FK506-binding peptidyl-prolyl cis-trans isomerases (PPIases). PPIases accelerate the folding of proteins during protein synthesis. FKBP14 is localized in the endoplasmic reticulum (ER) and that deficiency of FKBP14 leads to enlarged ER cisterns in dermal fibroblasts in vivo. FKBP14 is about 22kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8668 Product name: Recombinant human FKBP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-211 aa of BC005206 Sequence: LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL Predict reactive species\nFull Name: FK506 binding protein 14, 22 kDa\nCalculated Molecular Weight: 211 aa, 24 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC005206\nGene Symbol: FKBP14\nGene ID (NCBI): 55033\nRRID: AB_2102702\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869406744745,"sku":"15884-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15884-1-ap","provider":"Iright","version":"1.0","type":"link"}