{"product_id":"proteintech-15887-1-ap","title":"Proteintech, 15887-1-AP, EIF1, EIF1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF1, EIF1B (15887-1-AP) by Proteintech is a Polyclonal antibody targeting EIF1, EIF1B in WB, IHC, ELISA applications with reactivity to human samples\n15887-1-AP targets EIF1, EIF1B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8673 Product name: Recombinant human EIF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006996 Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF Predict reactive species\nFull Name: eukaryotic translation initiation factor 1B\nCalculated Molecular Weight: 113 aa, 13 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC006996\nGene Symbol: EIF1B\nGene ID (NCBI): 10289\nRRID: AB_2878196\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60739\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887471284393,"sku":"15887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15887-1-ap","provider":"Iright","version":"1.0","type":"link"}