{"product_id":"proteintech-15889-1-ap","title":"Proteintech, 15889-1-AP, NDUFA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA2 (15889-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15889-1-AP targets NDUFA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse liver tissue,  rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2), also known as NADH ubiquinone oxidoreductase B8 subunit, is one of accessory subunits of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFS2 is vital for growth, ROS generation, membrane integrity, apoptosis, and mitochondrial energetics.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8675 Product name: Recombinant human NDUFA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC003674 Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa\nCalculated Molecular Weight: 99 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC003674\nGene Symbol: NDUFA2\nGene ID (NCBI): 4695\nRRID: AB_3669223\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887734018217,"sku":"15889-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15889-1-ap","provider":"Iright","version":"1.0","type":"link"}