{"product_id":"proteintech-15902-1-ap","title":"Proteintech, 15902-1-AP, GSTP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTP1 (15902-1-AP) by Proteintech is a Polyclonal antibody targeting GSTP1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15902-1-AP targets GSTP1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, human brain tissue,  HeLa cells,  HEK-293 cells,  K-562 cells,  Jurkat cells,  PC-3 cells,  mouse brain tissue,  mouse heart tissue,  rat brain tissue,  rat heart tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse skin tissue, human  colon,  human liver tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlutathione S-transferase Pi (GSTP1) is anisozyme encoded by the GST pi gene that plays an importantregulatory role in detoxification, anti‑oxidative damage, and the occurrence of various diseases (PMID: 14755684). GSTP1 conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PMID:9084911). GSTP1 methylation is frequently associated with tumor development or poor prognosis in a wide range of tumors such as neuroblastoma, hepatocellular carcinoma, endometrial, breast, and prostate cancers (PCa) (PMID: 27594734).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8731 Product name: Recombinant human GSTP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species\nFull Name: glutathione S-transferase pi 1\nCalculated Molecular Weight: 210 aa, 23 kDa\nObserved Molecular Weight: 23-28 kDa\nGenBank Accession Number: BC010915\nGene Symbol: GSTP1\nGene ID (NCBI): 2950\nRRID: AB_2116216\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09211\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868850737321,"sku":"15902-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15902-1-ap","provider":"Iright","version":"1.0","type":"link"}