{"product_id":"proteintech-15976-1-ap","title":"Proteintech, 15976-1-AP, PSMB10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB10 (15976-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB10 in WB, IHC, ELISA applications with reactivity to human samples\n15976-1-AP targets PSMB10 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, human liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe proteasome subunit, beta type 10 (PSMB10) gene regulated by interferon-gamma is a core part of the 26S proteasome complex, which is an important protein degrading system. Study identifies immunosubunit PSMB10 as a novel regulator that contributes to Ang II-induced atrial fibrillation (AF) and suggests that inhibition of PSMB10 may represent a potential therapeutic target for treating hypertensive AF. (PMID: 29507100, PMID: 16965406)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8764 Product name: Recombinant human PSMB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC017198 Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 10\nCalculated Molecular Weight: 273 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC017198\nGene Symbol: PSMB10\nGene ID (NCBI): 5699\nRRID: AB_2171872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40306\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972339369,"sku":"15976-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-15976-1-ap","provider":"Iright","version":"1.0","type":"link"}