{"product_id":"proteintech-16004-1-ap","title":"Proteintech, 16004-1-AP, NBR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NBR1 (16004-1-AP) by Proteintech is a Polyclonal antibody targeting NBR1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples\n16004-1-AP targets NBR1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, COS-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse heart tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNBR1, also named as 1A13B, KIAA0049 and M17S2, acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets. NBR1 and P62 can bind to autophagic effector proteins (Atg8 in yeast, MAP1LC3 protein family in mammals) anchored in the membrane of autophagosomes. It is a highly conserved multidomain scaffold protein with proposed roles in endocytic trafficking and selective autophagy. NBR1 is a novel PB1 adapter in Th2 differentiation and asthma. It functions as an autophagy receptor involved in targeting ubiquitinated proteins for degradation. It also has a dual role as a scaffold protein to regulate growth-factor receptor and downstream signaling pathways. Observed MW of NBR1 is 140 kDa (PMID: 22654911, PMID: 22484440).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, pig, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8652 Product name: Recombinant human NBR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC009808 Sequence: MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ Predict reactive species\nFull Name: neighbor of BRCA1 gene 1\nCalculated Molecular Weight: 966 aa, 107 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC009808\nGene Symbol: NBR1\nGene ID (NCBI): 4077\nRRID: AB_2251178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14596\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836778153,"sku":"16004-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16004-1-ap","provider":"Iright","version":"1.0","type":"link"}