{"product_id":"proteintech-16005-1-ap","title":"Proteintech, 16005-1-AP, GTF2H2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF2H2 (16005-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2H2 in WB, ELISA applications with reactivity to human, mouse samples\n16005-1-AP targets GTF2H2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscription factor IIH(TFIIH) is associated with the RNA polymerase II transcription complex, which is involved in transcription and transcription-mediated DNA repair. GTF2H2(GENERAL TRANSCRIPTION FACTOR IIH, POLYPEPTIDE 2) is one of the six subnuits forming the core-TFIIH basal transcriptional factor.  TFIIH plays a role in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. The N terminus of GTF2H2 interacts with and regulates XPD, and an intact C terminus is required for a successful escape of RNAPol II from the promoter. This is a rabbit polyclonal antibody producted by part of N-terminal GTF2H2 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8653 Product name: Recombinant human GTF2H2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC005345 Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN Predict reactive species\nFull Name: general transcription factor IIH, polypeptide 2, 44kDa\nCalculated Molecular Weight: 395aa,44 kDa; 165aa,19 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC005345\nGene Symbol: GTF2H2\nGene ID (NCBI): 2966\nRRID: AB_2279415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13888\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690712233,"sku":"16005-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16005-1-ap","provider":"Iright","version":"1.0","type":"link"}