{"product_id":"proteintech-16006-1-ap","title":"Proteintech, 16006-1-AP, CISD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CISD1 (16006-1-AP) by Proteintech is a Polyclonal antibody targeting CISD1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16006-1-AP targets CISD1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse skeletal muscle tissue,  rat kidney tissue,  rat skeletal muscle tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8680 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species\nFull Name: CDGSH iron sulfur domain 1\nCalculated Molecular Weight: 108 aa, 12 kDa\nObserved Molecular Weight: 14-17 kDa\nGenBank Accession Number: BC007043\nGene Symbol: CISD1\nGene ID (NCBI): 55847\nRRID: AB_2080268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZ45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842414249,"sku":"16006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16006-1-ap","provider":"Iright","version":"1.0","type":"link"}