{"product_id":"proteintech-16009-1-ap","title":"Proteintech, 16009-1-AP, PLA2G12A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLA2G12A (16009-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G12A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16009-1-AP targets PLA2G12A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  HEK-293 cells,  mouse heart tissue,  mouse kidney tissue\nPositive IHC detected in: human colon cancer tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLA2G12A (or PLA2G12) gene encodes group XII secreted phospholipase A2 (sPLA2) which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Cellular arachidonate (AA) release and prostaglandin (PG) production is regulated by sPLA(2)s, groups III and XII. Group XII sPLA2 have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. Cells transfected with group XII sPLA(2) exhibited abnormal morphology, suggesting a unique functional aspect of this enzyme. Role of sPLA2s as potential tumour biomarkers and therapeutic targets for various cancers have been reported.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8722 Product name: Recombinant human PLA2G12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-189 aa of BC017218 Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL Predict reactive species\nFull Name: phospholipase A2, group XIIA\nCalculated Molecular Weight: 189 aa, 21 kDa\nObserved Molecular Weight: 21-24 kDa\nGenBank Accession Number: BC017218\nGene Symbol: PLA2G12A\nGene ID (NCBI): 81579\nRRID: AB_2164314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007270057,"sku":"16009-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16009-1-ap","provider":"Iright","version":"1.0","type":"link"}