{"product_id":"proteintech-16025-1-ap","title":"Proteintech, 16025-1-AP, Cystatin SN\/CST1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cystatin SN\/CST1 (16025-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin SN\/CST1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n16025-1-AP targets Cystatin SN\/CST1 in WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, COLO 320 cells,  human adrenal gland tissue,  human testis tissue,  human saliva,  SW480 cells,  mouse skin tissue\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCST1, or cystatin SN, is a gene in humans that encodes a secreted protein belonging to the type 2 cystatin superfamily, which includes CST1, CST2, CST3, CST4, and CST5. These proteins are cysteine proteinase inhibitors found in various human fluids and secretions, where they appear to provide protective functions. CST1 is specifically found in saliva, tears, urine, and seminal fluid, and it plays a role in inhibiting the activity of cysteine proteases. CST1 has been implicated in various pathological processes, including tumor invasion and metastasis. Overexpression of CST1 has been observed in several types of cancer, such as lung, breast, colorectal, and gastric cancer, suggesting its role in the proliferation, invasion, and metastasis of these tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8862 Product name: Recombinant human CST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-141 aa of BC021225 Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES Predict reactive species\nFull Name: cystatin SN\nCalculated Molecular Weight: 141 aa, 16 kDa\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC021225\nGene Symbol: CST1\nGene ID (NCBI): 1469\nRRID: AB_10916385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01037\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893270185,"sku":"16025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16025-1-ap","provider":"Iright","version":"1.0","type":"link"}