{"product_id":"proteintech-16027-1-ap","title":"Proteintech, 16027-1-AP, S100A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A1 (16027-1-AP) by Proteintech is a Polyclonal antibody targeting S100A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n16027-1-AP targets S100A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue\nPositive IHC detected in: human malignant melanoma tissue, human kidney tissue,  human ovary tumor tissue,  human appendicitis tissue,  human tonsillitis tissue,  rat brain tissue,  human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human ovary cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8871 Product name: Recombinant human S100A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species\nFull Name: S100 calcium binding protein A1\nCalculated Molecular Weight: 94 aa, 11 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC014392\nGene Symbol: S100A1\nGene ID (NCBI): 6271\nRRID: AB_2183214\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936523945,"sku":"16027-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16027-1-ap","provider":"Iright","version":"1.0","type":"link"}