{"product_id":"proteintech-16045-1-ap","title":"Proteintech, 16045-1-AP, PFDN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFDN4 (16045-1-AP) by Proteintech is a Polyclonal antibody targeting PFDN4 in WB, IHC, ELISA applications with reactivity to human samples\n16045-1-AP targets PFDN4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Raji cells,  THP-1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human PFDN4, prefoldin 4, is a subunit of the heterohexameric chaperone protein and belongs to the prefoldin family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Previous reports have shown that PFDN4 is upregulated in breast cancer cell lines and tumor tissues (PMID: 11381030; PMID: 9630229). PFDN4 expression may be a prognostic factor in colorectal cancer (PMID: 20552408).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8938 Product name: Recombinant human PFDN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC010953 Sequence: MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES Predict reactive species\nFull Name: prefoldin subunit 4\nCalculated Molecular Weight: 134 aa, 15 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC010953\nGene Symbol: PFDN4\nGene ID (NCBI): 5203\nRRID: AB_2162573\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQP4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869482438825,"sku":"16045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16045-1-ap","provider":"Iright","version":"1.0","type":"link"}