{"product_id":"proteintech-16048-1-ap","title":"Proteintech, 16048-1-AP, Myoglobin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Myoglobin (16048-1-AP) by Proteintech is a Polyclonal antibody targeting Myoglobin in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16048-1-AP targets Myoglobin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle,  rat heart,  rat skeletal muscle\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9000 Product name: Recombinant human MB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species\nFull Name: myoglobin\nCalculated Molecular Weight: 154 aa, 17 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC014547\nGene Symbol: Myoglobin\nGene ID (NCBI): 4151\nRRID: AB_1640050\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02144\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970569897,"sku":"16048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16048-1-ap","provider":"Iright","version":"1.0","type":"link"}