{"product_id":"proteintech-16054-1-ap","title":"Proteintech, 16054-1-AP, ATP6V1C1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V1C1 (16054-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1C1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16054-1-AP targets ATP6V1C1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  human brain tissue,  human testis tissue,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe vacuolar H+-ATPase (V-ATPase) is a functionally conserved multimeric complex localized at the membranes of many organelles where its proton-pumping action is required for proper lumen acidification (PMID: 39210597). ATP6V1C1, also known as  ATPase, H+ transporting, lysosomal V1 subunit C1, is a component of the V1 sector of the V-ATPase complex. ATP6v1c1 knockdown significantly reduces tumor stimulated bone resorption through osteoclastogenesis at the bone and metastasis in vivo, as well as V-ATPase activity, proliferation, and mTORC1 activation in vitro (PMID: 28504970). Also, ATP6V1C1, associated with the tumor microenvironment and mTORC1 signaling pathway, is a potential diagnostic, prognostic, and therapeutic biomarker for hepatocellular carcinoma () (PMID: 39557733).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9020 Product name: Recombinant human ATP6V1C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC010960 Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEF Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1\nCalculated Molecular Weight: 382 aa, 44 kDa\nObserved Molecular Weight: 42-44 kDa\nGenBank Accession Number: BC010960\nGene Symbol: ATP6V1C1\nGene ID (NCBI): 528\nRRID: AB_2062501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21283\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922859689,"sku":"16054-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16054-1-ap","provider":"Iright","version":"1.0","type":"link"}