{"product_id":"proteintech-16055-1-ap","title":"Proteintech, 16055-1-AP, LYPLA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYPLA1 (16055-1-AP) by Proteintech is a Polyclonal antibody targeting LYPLA1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16055-1-AP targets LYPLA1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  human brain tissue,  human liver tissue,  rat liver tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYPLA1(Lysophospholipase 1) is also named as APT1(Acyl-protein thioesterase 1), LPL1 and belongs to the AB hydrolase 2 family. It is an important enzyme responsible for depalmitoylation of palmitoyl proteins and works as a thioesterase that cleaves the S-palmitoyl group of H-Ras, heterotrimeric G protein alfa subunit (Ga) , regulator of G protein signaling 4 (RGS4) and the endothelial isoform of nitric oxide synthase (eNOS) in vitro(PMID:19439193).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9022 Product name: Recombinant human LYPLA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC010397 Sequence: MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID Predict reactive species\nFull Name: lysophospholipase I\nCalculated Molecular Weight: 230 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC010397\nGene Symbol: LYPLA1\nGene ID (NCBI): 10434\nRRID: AB_2234851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75608\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925677737,"sku":"16055-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16055-1-ap","provider":"Iright","version":"1.0","type":"link"}