{"product_id":"proteintech-16098-1-ap","title":"Proteintech, 16098-1-AP, NUDT8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT8 (16098-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16098-1-AP targets NUDT8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human heart tissue,  human kidney tissue,  human skin tissue,  mouse heart tissue,  human liver tissue,  human spleen tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT8 belongs to the Nudix hydrolase family, which is involved in intracellular metabolic processes, especially related to the decomposition and degradation of nucleotides. NUDT8 is a novel CoA diphosphohydrolase that localizes to the mitochondria and is broadly expressed in mitochondria-rich organs such as the heart, kidneys, liver, and brown adipose tissue(PMID: 31004344).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8945 Product name: Recombinant human NUDT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC018644 Sequence: MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVSWGI Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 8\nCalculated Molecular Weight: 236 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC018644\nGene Symbol: NUDT8\nGene ID (NCBI): 254552\nRRID: AB_2154132\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WV74\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869721612457,"sku":"16098-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16098-1-ap","provider":"Iright","version":"1.0","type":"link"}