{"product_id":"proteintech-16126-1-ap","title":"Proteintech, 16126-1-AP, PGAM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGAM1 (16126-1-AP) by Proteintech is a Polyclonal antibody targeting PGAM1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16126-1-AP targets PGAM1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  NIH\/3T3 cells,  Raji cells,  HeLa cells,  HEK-293T cells,  Jurkat cells,  CHO cells\nPositive IHC detected in: human normal colon, human brain tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9110 Product name: Recombinant human PGAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC011678 Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK Predict reactive species\nFull Name: phosphoglycerate mutase 1 (brain)\nCalculated Molecular Weight: 254 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC011678\nGene Symbol: PGAM1\nGene ID (NCBI): 5223\nRRID: AB_2160786\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18669\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851687593,"sku":"16126-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16126-1-ap","provider":"Iright","version":"1.0","type":"link"}