{"product_id":"proteintech-16139-1-ap","title":"Proteintech, 16139-1-AP, MRPS18B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS18B (16139-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS18B in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n16139-1-AP targets MRPS18B in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse liver tissue,  rat heart tissue,  HEK-293 cells,  MCF-7 cells,  PC-3 cells,  SH-SY5Y cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPS18B, also named as S18mt-b, MRP-S18-2 and C6orf14, belongs to the ribosomal protein S18P family. It is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. This antibody recognizes specifically the 29 kd MRPS18B protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9198 Product name: Recombinant human MRPS18B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC005373 Sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL Predict reactive species\nFull Name: mitochondrial ribosomal protein S18B\nCalculated Molecular Weight: 258 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC005373\nGene Symbol: MRPS18B\nGene ID (NCBI): 28973\nRRID: AB_2146368\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868838842537,"sku":"16139-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16139-1-ap","provider":"Iright","version":"1.0","type":"link"}