{"product_id":"proteintech-16144-1-ap","title":"Proteintech, 16144-1-AP, PSENEN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSENEN (16144-1-AP) by Proteintech is a Polyclonal antibody targeting PSENEN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16144-1-AP targets PSENEN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Neuro-2a cells,  mouse lung tissue,  rat spleen tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9243 Product name: Recombinant human PSENEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC009575 Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP Predict reactive species\nFull Name: presenilin enhancer 2 homolog (C. elegans)\nCalculated Molecular Weight: 101 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC009575\nGene Symbol: PSENEN\nGene ID (NCBI): 55851\nRRID: AB_3669231\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZ42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887775830185,"sku":"16144-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16144-1-ap","provider":"Iright","version":"1.0","type":"link"}