{"product_id":"proteintech-16199-1-ap","title":"Proteintech, 16199-1-AP, HTF9C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HTF9C (16199-1-AP) by Proteintech is a Polyclonal antibody targeting HTF9C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16199-1-AP targets HTF9C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  HepG2 cells,  mouse liver tissue\nPositive IHC detected in: human kidney tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\ntRNA methyltransferase 2 homolog A (TRMT2A), also known as HTF9C is a novel cell cycle regulated protein, as associated with aggressive clinical course. HTF9C harbors a putative RNA recognition motif (RRM) in the N-terminus and the conserved uracil-C5-methyltransferase domain of the TrmA family in the C-terminus. HTF9C antibody can detect two bands about 68 kDa and 40 kDa (PMID: 20307320).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9112 Product name: Recombinant human TRMT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 277-625 aa of BC013352 Sequence: DTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS Predict reactive species\nFull Name: TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 625 aa, 69 kDa\nObserved Molecular Weight: 42-44 kDa, 68-75 kDa\nGenBank Accession Number: BC013352\nGene Symbol: TRMT2A\nGene ID (NCBI): 27037\nRRID: AB_2209623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZ69\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869549416617,"sku":"16199-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16199-1-ap","provider":"Iright","version":"1.0","type":"link"}