{"product_id":"proteintech-16204-1-ap","title":"Proteintech, 16204-1-AP, ACSS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACSS3 (16204-1-AP) by Proteintech is a Polyclonal antibody targeting ACSS3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16204-1-AP targets ACSS3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9173 Product name: Recombinant human ACSS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-686 aa of BC009317 Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA Predict reactive species\nFull Name: acyl-CoA synthetase short-chain family member 3\nCalculated Molecular Weight: 686 aa, 75 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC009317\nGene Symbol: ACSS3\nGene ID (NCBI): 79611\nRRID: AB_2257893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6R3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931608745,"sku":"16204-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16204-1-ap","provider":"Iright","version":"1.0","type":"link"}