{"product_id":"proteintech-16256-1-ap","title":"Proteintech, 16256-1-AP, CHMP4C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHMP4C (16256-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP4C in WB, ELISA applications with reactivity to human samples\n16256-1-AP targets CHMP4C in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHMP4C (Charged multivesicular body protein 4c), also known as SHAX3. It is expected to be located in the cytoplasm and membrane, which is expressed in heart, spleen and kidney. CHMP4C is one of the charged multivesicular protein (CHMP), and is involved in the composition of the endosomal sorting complex required for transport III (ESCRT-III), facilitating the necessary separation of daughter cells. CHMP4C has been proposed to be involved in the progression of different carcinomas. The molecular weight of CHMP4C is 26 kDa. Phosphorylated at Ser-210 by AURKB during cytokinesis: together with ZFYVE19\/ANCHR, phosphorylated CHMP4C retains abscission-competent VPS4 (VPS4A and\/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Phosphorylation and ubiquitination modification may lead to molecular weight of 35-42kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9279 Product name: Recombinant human CHMP4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC014321 Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT Predict reactive species\nFull Name: chromatin modifying protein 4C\nCalculated Molecular Weight: 233 aa, 26 kDa\nObserved Molecular Weight: 35 -42 kDa\nGenBank Accession Number: BC014321\nGene Symbol: CHMP4C\nGene ID (NCBI): 92421\nRRID: AB_3669233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CF2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869524611241,"sku":"16256-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16256-1-ap","provider":"Iright","version":"1.0","type":"link"}