{"product_id":"proteintech-16261-1-ap","title":"Proteintech, 16261-1-AP, HTN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HTN3 (16261-1-AP) by Proteintech is a Polyclonal antibody targeting HTN3 in WB, ELISA applications with reactivity to human samples\n16261-1-AP targets HTN3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistatins are a family of salivary proteins that have antibacterial properties. HTN3, also known as Histatin-3, is an important saliva component and a major precursor for forming the enamel film on the tooth surface.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9302 Product name: Recombinant human HTN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-51 aa of BC009791 Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN Predict reactive species\nFull Name: histatin 3\nCalculated Molecular Weight: 51 aa, 6 kDa\nObserved Molecular Weight: 6-7 kDa\nGenBank Accession Number: BC009791\nGene Symbol: HTN3\nGene ID (NCBI): 3347\nRRID: AB_3669234\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15516\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887673299113,"sku":"16261-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16261-1-ap","provider":"Iright","version":"1.0","type":"link"}