{"product_id":"proteintech-16266-1-ap","title":"Proteintech, 16266-1-AP, RAP2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAP2B (16266-1-AP) by Proteintech is a Polyclonal antibody targeting RAP2B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16266-1-AP targets RAP2B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, MCF-7 cells,  rat brain tissue,  HEK-293 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAP2B belongs to a family of RAS-related genes. It share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. Rap2B is a platelet protein that is activated by thrombin and involved in platelet activation. RAP2B may be a novel candidate oncogene that plays important roles in carcinogenesis through activation of NF-kappaB pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9331 Product name: Recombinant human RAP2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC012362 Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL Predict reactive species\nFull Name: RAP2B, member of RAS oncogene family\nCalculated Molecular Weight: 183 aa, 21 kDa\nObserved Molecular Weight: 19-22 kDa\nGenBank Accession Number: BC012362\nGene Symbol: RAP2B\nGene ID (NCBI): 5912\nRRID: AB_2177311\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61225\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869749072041,"sku":"16266-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16266-1-ap","provider":"Iright","version":"1.0","type":"link"}