{"product_id":"proteintech-16294-1-ap","title":"Proteintech, 16294-1-AP, SPAG7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAG7 (16294-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16294-1-AP targets SPAG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, mouse brain tissue,  mouse skeletal muscle tissue,  rat brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPAG7 encodes the sperm-associated antigen 7, which is widely expressed. The SPAG7 protein contains two nuclear localisation signals and a R3H domain. The domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner. This might indicate a potential role of the protein in response to viruses or free DNAs or RNAs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9471 Product name: Recombinant human SPAG7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-227 aa of BC011934 Sequence: MADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGCVPVANKRDTRSIEEAMNEIRAKKRLRQSGEELPPTS Predict reactive species\nFull Name: sperm associated antigen 7\nCalculated Molecular Weight: 227 aa, 26 kDa\nObserved Molecular Weight: 26-31 kDa\nGenBank Accession Number: BC011934\nGene Symbol: SPAG7\nGene ID (NCBI): 9552\nRRID: AB_2302478\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75391\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812923561,"sku":"16294-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16294-1-ap","provider":"Iright","version":"1.0","type":"link"}