{"product_id":"proteintech-16331-1-ap","title":"Proteintech, 16331-1-AP, OCTN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OCTN2 (16331-1-AP) by Proteintech is a Polyclonal antibody targeting OCTN2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16331-1-AP targets OCTN2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue, mouse skeletal muscle tissue,  human placenta tissue,  mouse pancreas tissue,  mouse testis tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOCTN2 (Organic Cation\/Carnitine Transporter 2), encoded by SLC22A5, is a ubiquitously expressed organic anion\/cation transporter. OCTN2 plays a key role in absorption, tissue distribution and renal reabsorption of L-carnitine which is an essential cofactor in fat metabolism. Defects in the OCTN2 are responsible for primary carnitine deficiency. OCTN2 also transports some important respiratory medicines (such as tiotropium), and due to its expression in the lung, may influence the disposition and absorption of these medicines in the lung.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9450 Product name: Recombinant human SLC22A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC012325 Sequence: MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCPDGWEFSQDVYLSTIVTEWNLVCEDDWKA Predict reactive species\nFull Name: solute carrier family 22 (organic cation\/carnitine transporter), member 5\nCalculated Molecular Weight: 557 aa, 63 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC012325\nGene Symbol: OCTN2\nGene ID (NCBI): 6584\nRRID: AB_2191406\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76082\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919943337,"sku":"16331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16331-1-ap","provider":"Iright","version":"1.0","type":"link"}