{"product_id":"proteintech-16347-1-ap","title":"Proteintech, 16347-1-AP, PAH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAH (16347-1-AP) by Proteintech is a Polyclonal antibody targeting PAH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16347-1-AP targets PAH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HepG2 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAH, also known as PH, belongs to the aromatic amino acid hydroxylase (AAAH) enzyme family. PAH catalyzes the conversion of L-phenylalanine (L-Phe) to L-tyrosine (L-Tyr) by para-hydroxylation of the aromatic side chain. PAH is primarily present in the liver, where removal of excess L-Phe prevents the neurotoxic effect of hyperphenylalaninemia (HPA). (PMID: 23457044)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9541 Product name: Recombinant human PAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-452 aa of BC026251 Sequence: VEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK Predict reactive species\nFull Name: phenylalanine hydroxylase\nCalculated Molecular Weight: 452 aa, 52 kDa\nObserved Molecular Weight: 45-52 kDa\nGenBank Accession Number: BC026251\nGene Symbol: PAH\nGene ID (NCBI): 5053\nRRID: AB_2878247\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420834985,"sku":"16347-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16347-1-ap","provider":"Iright","version":"1.0","type":"link"}