{"product_id":"proteintech-16355-1-ap","title":"Proteintech, 16355-1-AP, CYP2C9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYP2C9 (16355-1-AP) by Proteintech is a Polyclonal antibody targeting CYP2C9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16355-1-AP targets CYP2C9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, SMMC-7721 cells,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYP2C9 (Cytochrome P450 Family 2 Subfamily C Member 9) is a crucial cytochrome P450 enzyme, which plays a significant role in the metabolism, by oxidation, of both xenobiotic and endogenous compounds. CYP2C9 is primarily expressed in the liver, and the expression level is reported to be the second highest among CYP isoforms(PMID: 20150829).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9566 Product name: Recombinant human CYP2C9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-162 aa of BC020754 Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG Predict reactive species\nFull Name: cytochrome P450, family 2, subfamily C, polypeptide 9\nCalculated Molecular Weight: 162aa,18 kDa; 490aa,56 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC020754\nGene Symbol: CYP2C9\nGene ID (NCBI): 1559\nRRID: AB_3085487\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11712\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869668102313,"sku":"16355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16355-1-ap","provider":"Iright","version":"1.0","type":"link"}