{"product_id":"proteintech-16357-1-ap","title":"Proteintech, 16357-1-AP, cyclin I Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe cyclin I (16357-1-AP) by Proteintech is a Polyclonal antibody targeting cyclin I in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16357-1-AP targets cyclin I in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat skeletal muscle tissue,  mouse skeletal muscle tissue,  rat brain tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human brain tissue,  human liver tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human spleen tissue,  human testis tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0493 Product name: Recombinant human CCNI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 259-377 aa of BC004975 Sequence: VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM Predict reactive species\nFull Name: cyclin I\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC004975\nGene Symbol: CCNI\nGene ID (NCBI): 10983\nRRID: AB_2275606\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14094\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869667676329,"sku":"16357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16357-1-ap","provider":"Iright","version":"1.0","type":"link"}