{"product_id":"proteintech-16397-1-ap","title":"Proteintech, 16397-1-AP, SMAD9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMAD9 (16397-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16397-1-AP targets SMAD9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A549 cells,  HEK-293 cells,  HepG2 cells,  mouse lung tissue\nPositive IHC detected in: human prostate cancer tissue, human urothelial carcinoma tissue,  mouse heart tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMAD9 (also known as MADH9 or MAD homolog 9) is a key signaling molecule in the transforming growth factor-β (TGF-β) superfamily signaling pathway and belongs to the SMAD1\/5\/9 subgroup of receptor-regulated SMADs (R-SMADs). It is primarily activated and phosphorylated by BMP (bone morphogenetic protein) type I receptors. Once activated, SMAD9 forms a complex with the common SMAD4 (Co-SMAD), translocates into the nucleus, and acts as a transcription factor to regulate the expression of specific target genes. This process is involved in modulating a variety of critical biological processes, including cell proliferation, differentiation, apoptosis, and embryonic development. Mutations or abnormal expression of SMAD9 are associated with several diseases, particularly in pulmonary arterial hypertension, certain cancers, and vascular diseases, where it plays a significant role.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9490 Product name: Recombinant human SMAD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-352 aa of BC011559 Sequence: MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQL Predict reactive species\nFull Name: SMAD family member 9\nCalculated Molecular Weight: 430 aa, 49 kDa\nObserved Molecular Weight: 49-55 kDa\nGenBank Accession Number: BC011559\nGene Symbol: SMAD9\nGene ID (NCBI): 4093\nRRID: AB_2270847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15198\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869431287977,"sku":"16397-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16397-1-ap","provider":"Iright","version":"1.0","type":"link"}