{"product_id":"proteintech-16398-1-ap","title":"Proteintech, 16398-1-AP, Gamma Synuclein\/SNCG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Gamma Synuclein\/SNCG (16398-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Synuclein\/SNCG in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16398-1-AP targets Gamma Synuclein\/SNCG in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGamma synuclein, also known as SNCG, BCSG1, belongs to the synuclein family. SNCG is a synuclein protein found primarily in the peripheral nervous system and retina(PMID 11806835). SNCG is the least conserved of the synuclein proteins and is detected in the brain, ovarian tumors, and the olfactory epithelium(PMID 9750188). SNCG is expressed in high abundance in breast cancer but scarcely at all in a normal breast and is considered a breast cancer marker(PMID: 10813729).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9493 Product name: Recombinant human SNCG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC014098 Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Predict reactive species\nFull Name: synuclein, gamma (breast cancer-specific protein 1)\nCalculated Molecular Weight: 127 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC014098\nGene Symbol: SNCG\nGene ID (NCBI): 6623\nRRID: AB_3085489\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76070\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887647346857,"sku":"16398-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16398-1-ap","provider":"Iright","version":"1.0","type":"link"}