{"product_id":"proteintech-16477-1-ap","title":"Proteintech, 16477-1-AP, NECAB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NECAB1 (16477-1-AP) by Proteintech is a Polyclonal antibody targeting NECAB1 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n16477-1-AP targets NECAB1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNECAB1, also named as EFCBP1, is a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains Short Communication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9591 Product name: Recombinant human NECAB1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 252-351 aa of BC016340 Sequence: MLVQRQMSVMEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN Predict reactive species\nFull Name: N-terminal EF-hand calcium binding protein 1\nCalculated Molecular Weight: 351 aa, 40 kDa\nGenBank Accession Number: BC016340\nGene Symbol: NECAB1\nGene ID (NCBI): 64168\nRRID: AB_3085492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N987\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869717319849,"sku":"16477-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16477-1-ap","provider":"Iright","version":"1.0","type":"link"}