{"product_id":"proteintech-16480-1-ap","title":"Proteintech, 16480-1-AP, NDUFA4L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA4L2 (16480-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA4L2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16480-1-AP targets NDUFA4L2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  HUVEC cells,  HepG2 cells,  Jurkat clells,  PC-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissue, human kidney tissue,  human liver tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2\nCalculated Molecular Weight: 87 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC011910\nGene Symbol: NDUFA4L2\nGene ID (NCBI): 56901\nRRID: AB_2150637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861878441,"sku":"16480-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16480-1-ap","provider":"Iright","version":"1.0","type":"link"}