{"product_id":"proteintech-16482-1-ap","title":"Proteintech, 16482-1-AP, BTN2A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTN2A2 (16482-1-AP) by Proteintech is a Polyclonal antibody targeting BTN2A2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16482-1-AP targets BTN2A2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells, NIH\/3T3 cells,  MCF-7 cells,  human testis tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nButyrophilins constitute a family of transmembrane proteins consisting of butyrophilin (BTN), BTN-like (BTNL), and selection and upkeep of intraepithelial T cell (SKI NT) proteins. It has been reported that BTN2A2 is expressed on B cells, DCs, and macrophages and the expression levels are upregulated upon activation. BTN2A2 is also expressed on thymic epithelial cells (TECs). The BTN2A2 putative receptor is expressed on activated T cells. BTN2A2 protein inhibits T cell proliferation, metabolism and Th1 cytokine production(PMID: 34588505). The calculated MW of BTN2A2 is 59kDa, and the glycosylated form is around 65kDa (PMID:20208008).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9603 Product name: Recombinant human BTN2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-523 aa of BC014021 Sequence: VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTLEMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDDSPIFICPALTGASGVMVPEEGLKLHRVGTHQSL Predict reactive species\nFull Name: butyrophilin, subfamily 2, member A2\nCalculated Molecular Weight: 523 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC014021\nGene Symbol: BTN2A2\nGene ID (NCBI): 10385\nRRID: AB_2228110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVV5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885325439145,"sku":"16482-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16482-1-ap","provider":"Iright","version":"1.0","type":"link"}