{"product_id":"proteintech-16485-1-ap","title":"Proteintech, 16485-1-AP, CDC25C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC25C (16485-1-AP) by Proteintech is a Polyclonal antibody targeting CDC25C in WB, IHC, IP, ELISA applications with reactivity to human samples\n16485-1-AP targets CDC25C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Raji cells,  HeLa cells,  HepG2 cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C(cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells(PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop(PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa(PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9607 Product name: Recombinant human CDC25C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC019089 Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ Predict reactive species\nFull Name: cell division cycle 25 homolog C (S. pombe)\nCalculated Molecular Weight: 473 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC019089\nGene Symbol: CDC25C\nGene ID (NCBI): 995\nRRID: AB_2291330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853981353,"sku":"16485-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16485-1-ap","provider":"Iright","version":"1.0","type":"link"}