{"product_id":"proteintech-16487-1-ap","title":"Proteintech, 16487-1-AP, RPL26L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPL26L1 (16487-1-AP) by Proteintech is a Polyclonal antibody targeting RPL26L1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16487-1-AP targets RPL26L1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  MCF-7 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPL26L1, also named as RPL26P1, belongs to the universal ribosomal protein uL24 family. RPL26L1 shares high sequence similarity with ribosomal protein L26 and plays a role in protein synthesis (PMID: 31673979). The molecular mass of RPL26L1 is 17 kDa. Studies have shown that RPL26L1 is related to autism spectrum disorder and is one of the potential biomarkers of the neurodegenerative disease Friedreich's ataxia. In addition, RPL26L1 may be closely related with SLE development (PMID: 31889427).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9609 Product name: Recombinant human RPL26L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC017360 Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE Predict reactive species\nFull Name: ribosomal protein L26-like 1\nCalculated Molecular Weight: 145 aa, 17 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC017360\nGene Symbol: RPL26L1\nGene ID (NCBI): 51121\nRRID: AB_2181740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869757853865,"sku":"16487-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16487-1-ap","provider":"Iright","version":"1.0","type":"link"}