{"product_id":"proteintech-16514-1-ap","title":"Proteintech, 16514-1-AP, DUSP22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP22 (16514-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP22 in WB, ELISA applications with reactivity to human, mouse samples\n16514-1-AP targets DUSP22 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9734 Product name: Recombinant human DUSP22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC022847 Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL Predict reactive species\nFull Name: dual specificity phosphatase 22\nCalculated Molecular Weight: 184 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC022847\nGene Symbol: DUSP22\nGene ID (NCBI): 56940\nRRID: AB_2095013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869533327529,"sku":"16514-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16514-1-ap","provider":"Iright","version":"1.0","type":"link"}