{"product_id":"proteintech-16537-1-ap","title":"Proteintech, 16537-1-AP, DYNLRB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNLRB2 (16537-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLRB2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n16537-1-AP targets DYNLRB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDYNLRB2(Dynein light chain roadblock-type-2) also known as DNCL2B, DNLC2B, belongs to the GAMAD family. DYNLRB2 is a male meiosis-upregulated dynein light chain that is indispensable for spindle formation in meiosis I (PMID: 36973253). DYNLRB2 expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients (PMID: 11750132).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9842 Product name: Recombinant human DYNLRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC054892 Sequence: MAEVEETLKRIQSHKGVIGTMVVNAEDPRFVTFKYARQLTAFQRKSGQQITIKD Predict reactive species\nFull Name: dynein, light chain, roadblock-type 2\nCalculated Molecular Weight: 54 aa, 6 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC054892\nGene Symbol: DYNLRB2\nGene ID (NCBI): 83657\nRRID: AB_3669248\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TF09\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887381532841,"sku":"16537-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16537-1-ap","provider":"Iright","version":"1.0","type":"link"}