{"product_id":"proteintech-16542-1-ap","title":"Proteintech, 16542-1-AP, CRYGS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRYGS (16542-1-AP) by Proteintech is a Polyclonal antibody targeting CRYGS in WB, ELISA applications with reactivity to human, rat samples\n16542-1-AP targets CRYGS in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRYGS (Gamma-S crystallin), also called CRYG8, belongs to the gamma-crystallins (PMID: 7733876; 23199295). Three major classes of crystallins, alpha, beta, and gamma, are common to the eye lens throughout all vertebrates. The beta and gamma classes are made up of homologous proteins and constitute the beta\/gamma crystallin superfamily. CRYGS is expressed late but abundantly in the ocular lens (PMID: 1445197). It is also expressed outside the lens, particularly in the mature retina and cornea. In contrast to the beta-crystallins which associate in various combinations to form low or high molecular weight aggregates, CRYGS is, like the other gamma-crystallins, a monomeric protein (PMID: 16141006).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9868 Product name: Recombinant human CRYGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC070241 Sequence: MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE Predict reactive species\nFull Name: crystallin, gamma S\nCalculated Molecular Weight: 178 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC070241\nGene Symbol: CRYGS\nGene ID (NCBI): 1427\nRRID: AB_3669249\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886887358633,"sku":"16542-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16542-1-ap","provider":"Iright","version":"1.0","type":"link"}