{"product_id":"proteintech-16590-1-ap","title":"Proteintech, 16590-1-AP, MED31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED31 (16590-1-AP) by Proteintech is a Polyclonal antibody targeting MED31 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16590-1-AP targets MED31 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  human brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMED31, also named as SOH1 or CGI-125, is a 131 amino acid protein, which belongs to the Mediator complex subunit 31 family. MED31 localizes in the nucleus. MED31 as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. MED31 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9008 Product name: Recombinant human MED31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC012539 Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK Predict reactive species\nFull Name: mediator complex subunit 31\nCalculated Molecular Weight: 131 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC012539\nGene Symbol: MED31\nGene ID (NCBI): 51003\nRRID: AB_2142447\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3C7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869708603561,"sku":"16590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16590-1-ap","provider":"Iright","version":"1.0","type":"link"}