{"product_id":"proteintech-16595-1-ap","title":"Proteintech, 16595-1-AP, ZNHIT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNHIT1 (16595-1-AP) by Proteintech is a Polyclonal antibody targeting ZNHIT1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16595-1-AP targets ZNHIT1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  PC-12 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNHIT1(Zinc finger HIT domain containing protein 1), aslo named CGBP1 (Cyclin G1 binding protein 1), is a subunit of the SNF-2 related CBP activator protein (SRCAP) complex, which can remodel chromatin by incorporating the histone variant H2A.Z into nucleosomes(PMID: 15647280). ZNHIT1 also can bind to myogenin promoter and mediate H2A.Z incorporation for its expression(PMID: 20473270). ZNHIT1 overexpression induces apoptosis and represses proliferation and invasion of breast cancer cells(PMID: 30928405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9741 Product name: Recombinant human ZNHIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC017333 Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV Predict reactive species\nFull Name: zinc finger, HIT type 1\nCalculated Molecular Weight: 154 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC017333\nGene Symbol: ZNHIT1\nGene ID (NCBI): 10467\nRRID: AB_2220382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43257\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629108393,"sku":"16595-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16595-1-ap","provider":"Iright","version":"1.0","type":"link"}