{"product_id":"proteintech-16601-1-ap","title":"Proteintech, 16601-1-AP, PGCP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGCP (16601-1-AP) by Proteintech is a Polyclonal antibody targeting PGCP in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n16601-1-AP targets PGCP in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  human placenta tissue,  human plasma tissue,  mouse kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGCP(plasma glutamate carboxypeptidase) is also named as LCH1,CPQ and belongs to the peptidase M28 family. It may play an important role in the hydrolysis of circulating peptides. It catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. It is a proteinase that acts on the unsubstituted N- and C-termini of dipeptides. It has been suggested that this PGCP is involved in the release of thyroxine(PMID:20951214). Human PGCP is a metallopeptidase with five potential glycosylation sites, whose activity depends on dimerizationand it can be detected a band of 65-72kd in FRTL-5 cells which is pro-PGCP(PMID:22127294). It can be N-glycosylated(PMID:10206990). It has the pro-form of 60-65 kDa and mature form of 55 kDa(PMID:20951214).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9770 Product name: Recombinant human PGCP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-472 aa of BC020689 Sequence: LEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS Predict reactive species\nFull Name: plasma glutamate carboxypeptidase\nCalculated Molecular Weight: 472 aa, 52 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC020689\nGene Symbol: PGCP\nGene ID (NCBI): 10404\nRRID: AB_2160929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y646\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869006483625,"sku":"16601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16601-1-ap","provider":"Iright","version":"1.0","type":"link"}