{"product_id":"proteintech-16620-1-ap","title":"Proteintech, 16620-1-AP, INTS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INTS3 (16620-1-AP) by Proteintech is a Polyclonal antibody targeting INTS3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16620-1-AP targets INTS3 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINTS3 is a member of the integrator complex characterised as an RNA polymerase II (RNAPII) C-terminal domain binding factor involved in the processing of small nuclear RNAs (snRNAs) (PMID: 16239144). INTS3 was overexpressed in colorectal cancer (CRC) patients and tumour cell lines and inhibited CRC apoptosis by promoting the degradation of pro-apoptotic gene transcripts (PMID: 38665208).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9917 Product name: Recombinant human INTS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-445 aa of BC025254 Sequence: YHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD Predict reactive species\nFull Name: integrator complex subunit 3\nCalculated Molecular Weight: 118 kDa\nObserved Molecular Weight: 118 kDa\nGenBank Accession Number: BC025254\nGene Symbol: INTS3\nGene ID (NCBI): 65123\nRRID: AB_2127274\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q68E01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906573993,"sku":"16620-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16620-1-ap","provider":"Iright","version":"1.0","type":"link"}