{"product_id":"proteintech-16627-1-ap","title":"Proteintech, 16627-1-AP, CRTAM\/CD355 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRTAM\/CD355 (16627-1-AP) by Proteintech is a Polyclonal antibody targeting CRTAM\/CD355 in WB, ELISA applications with reactivity to mouse, rat samples\n16627-1-AP targets CRTAM\/CD355 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse thymus tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). The predicted molecular weight of CRTAM is 43 kDa. Due to glycosylation, the observed molecular weight of CRTAM can be apparent at ~80 kDa (PMID: 16300832).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9956 Product name: Recombinant human CRTAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-292 aa of BC070266 Sequence: NHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLT Predict reactive species\nFull Name: cytotoxic and regulatory T cell molecule\nCalculated Molecular Weight: 393 aa, 45 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC070266\nGene Symbol: CRTAM\nGene ID (NCBI): 56253\nRRID: AB_3085502\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95727\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886877266089,"sku":"16627-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16627-1-ap","provider":"Iright","version":"1.0","type":"link"}