{"product_id":"proteintech-16628-1-ap","title":"Proteintech, 16628-1-AP, COPS7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COPS7A (16628-1-AP) by Proteintech is a Polyclonal antibody targeting COPS7A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16628-1-AP targets COPS7A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse brain tissue,  PC-12 cells,  HeLa cells,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOPS7A is component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. COPS7A was consistently expressed in oligodendrocyte lineage cells, and was down-regulated during the peak period of myelination. COPS7A associated physically with Olig1, and it might thus serve as a novel negative regulator in oligodendrocytes differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9958 Product name: Recombinant human COPS7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC011789 Sequence: MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN Predict reactive species\nFull Name: COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis)\nCalculated Molecular Weight: 275 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC011789\nGene Symbol: COPS7A\nGene ID (NCBI): 50813\nRRID: AB_2081787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886810419369,"sku":"16628-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16628-1-ap","provider":"Iright","version":"1.0","type":"link"}