{"product_id":"proteintech-16638-1-ap","title":"Proteintech, 16638-1-AP, TMUB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMUB1 (16638-1-AP) by Proteintech is a Polyclonal antibody targeting TMUB1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n16638-1-AP targets TMUB1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, L02 cells\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane and ubiquitin-like domain-containing protein 1 (TMUB1), also referred to as hepatocyte odd protein shuttling (HOPS), is a transmembrane ubiquitin-like protein that was originally identified in the regenerated liver. HOPS is a transmembrane protein released into the cell by an enzymatic cleavage. This allows HOPS to be shuttled from the nucleus to the cytoplasm and vice versa, depending on cell cycle and environmental stress conditions. HOPS cDNA expression gives rise to the translation of three different proteins with distinct molecular weights of 27, 24 and 21 kDa, respectively.The three isoforms of HOPS are differentially expressed depending on the tissue being examined. In the brain, the shortest isoform prevails over the other, whereas in the intestine the higher molecular weight isoform prevails among the other two. Indeed, HOPS shows a different concentration of the three isoforms, which can play different cell-dependent functions. The ratio between different isoforms may vary owing to physiopathological changes in the cell (PMID:32860479).16638-1-AP can detect two bands and some literature also detected two bands (PMID:30610893, 29777440, 29967478)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9988 Product name: Recombinant human TMUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC000936 Sequence: MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP Predict reactive species\nFull Name: transmembrane and ubiquitin-like domain containing 1\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 27 kDa, 24 kDa\nGenBank Accession Number: BC000936\nGene Symbol: TMUB1\nGene ID (NCBI): 83590\nRRID: AB_3085503\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834058921,"sku":"16638-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16638-1-ap","provider":"Iright","version":"1.0","type":"link"}