{"product_id":"proteintech-16654-1-ap","title":"Proteintech, 16654-1-AP, COQ4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COQ4 (16654-1-AP) by Proteintech is a Polyclonal antibody targeting COQ4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16654-1-AP targets COQ4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, Transfected HEK-293 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman coenzyme Q4 (COQ4), as a component of the coenzyme Q biosynthetic pathway, is required for the oxidative decarboxylation of the C1 carbon of Coenzyme Q in eukaryotic cells (PMID: 38295803). COQ4 deficiency manifests as an early-onset neurodegenerative disorder. COQ4 encodes a ubiquitously expressed 265-amino-acid protein that is peripherally associated with the mitochondrial inner membrane on the matrix side (PMID: 25658047, 34656997)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10089 Product name: Recombinant human COQ4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC011895 Sequence: MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA Predict reactive species\nFull Name: coenzyme Q4 homolog (S. cerevisiae)\nCalculated Molecular Weight: 265 aa, 30 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC011895\nGene Symbol: COQ4\nGene ID (NCBI): 51117\nRRID: AB_2878296\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3A0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910768297,"sku":"16654-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16654-1-ap","provider":"Iright","version":"1.0","type":"link"}