{"product_id":"proteintech-16665-1-ap","title":"Proteintech, 16665-1-AP, Haptoglobin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Haptoglobin (16665-1-AP) by Proteintech is a Polyclonal antibody targeting Haptoglobin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16665-1-AP targets Haptoglobin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse serum, human plasma,  rat plasma\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn's disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10143 Product name: Recombinant human HP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-406 aa of BC058031 Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN Predict reactive species\nFull Name: haptoglobin\nCalculated Molecular Weight: 281aa,31 kDa; 228aa,25 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC058031\nGene Symbol: HP\nGene ID (NCBI): 3240\nRRID: AB_1939524\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00738\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868918239401,"sku":"16665-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16665-1-ap","provider":"Iright","version":"1.0","type":"link"}