{"product_id":"proteintech-16684-1-ap","title":"Proteintech, 16684-1-AP, DCTPP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCTPP1 (16684-1-AP) by Proteintech is a Polyclonal antibody targeting DCTPP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16684-1-AP targets DCTPP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  mouse heart tissue,  Transfected HEK-293 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCTPP1, also named as XTP3TPA, CDAO3 and RS21C6, is a hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. It has a central role in the balance of dCTP and the metabolism of deoxycytidine analogues, thus contributing to the preservation of genome integrity. DCTPP1 has some forms such as monomer (~20 kDa), Dimer (~40 kDa) and Homotetramer (~80 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10015 Product name: Recombinant human DCTPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC001344 Sequence: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST Predict reactive species\nFull Name: dCTP pyrophosphatase 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa, 40 kDa, 80 kDa\nGenBank Accession Number: BC001344\nGene Symbol: DCTPP1\nGene ID (NCBI): 79077\nRRID: AB_2878299\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H773\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869672558761,"sku":"16684-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16684-1-ap","provider":"Iright","version":"1.0","type":"link"}