{"product_id":"proteintech-16687-1-ap","title":"Proteintech, 16687-1-AP, Cytohesin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytohesin 3 (16687-1-AP) by Proteintech is a Polyclonal antibody targeting Cytohesin 3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n16687-1-AP targets Cytohesin 3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytohesin 3 (CYTH3), also known as GRP1, ARNO3, or PSCD3, is a member of the PSCD family of guanine nucleotide exchange factors (GEFs) that regulate ADP-ribosylation factor (ARF) GTPases. Through its Sec7 domain, CYTH3 facilitates the exchange of GDP for GTP on ARF proteins, thereby modulating vesicle biogenesis, protein sorting, and Golgi apparatus structure and function. Clinicopathological studies demonstrate that CYTH3 is significantly upregulated in hepatocellular carcinoma (HCC) and negatively correlates with patient survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10025 Product name: Recombinant human CYTH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-399 aa of BC008191 Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK Predict reactive species\nFull Name: cytohesin 3\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC008191\nGene Symbol: Cytohesin 3\nGene ID (NCBI): 9265\nRRID: AB_2261396\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43739\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887034683561,"sku":"16687-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16687-1-ap","provider":"Iright","version":"1.0","type":"link"}